DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG32376

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:299 Identity:79/299 - (26%)
Similarity:117/299 - (39%) Gaps:63/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RPNQPRGCGVRNTGGLDFTLSGVSQNEA---GFG------------------------------E 175
            |...|...|.....|..:.|.|..::.|   .||                              |
  Fly    12 RERDPSWSGYYKDNGTHYLLYGKPEDIAPTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTE 76

  Fly   176 FPWTVALLHSGNLSYF-CAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQERS 239
            .|:..:|.:.|   || |...:|:|..:|||.||... ....:|||.|     :.::|...|.|.
  Fly    77 APFQGSLHYEG---YFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVG-----SDQQRRGGQLRH 132

  Fly   240 VQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFG-- 302
            |:.::....||..::.:|.|::.|..||.....:..:.||.......|.....| |||..:..  
  Fly   133 VKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVS-GWGITSANAQ 196

  Fly   303 SLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPR 367
            ::.:|   ::||.:..::.:.||...:  :.|.|...|  .||| .:...|:|.||.|.||.   
  Fly   197 NVQRY---LRRVQIDYIKRSKCQKMYK--KAGLKIYKD--MICA-SRTNKDSCSGDSGGPLT--- 250

  Fly   368 GSTRESRYQQTGIVAWGIGC-NDEVPAAYANVALVRGWI 405
                 ||....|||:||||| |...|..|.|......||
  Fly   251 -----SRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 73/277 (26%)
Tryp_SPc 169..405 CDD:214473 71/272 (26%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 68/244 (28%)
Tryp_SPc 66..287 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.