DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Prss30

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:275 Identity:84/275 - (30%)
Similarity:131/275 - (47%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 PRGCG-VRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCV-E 210
            |..|| .|:.|.:      |...:|..|::||.|:|..:.: .:.|.|||||:..|||||||. .
Mouse    62 PSVCGHSRDAGKI------VGGQDALEGQWPWQVSLWITED-GHICGGSLIHEVWVLTAAHCFRR 119

  Fly   211 SLRTGSFTVRAGEWDTQTMKERLPYQER-SVQTVILHPDYN-RRSIAYDFALVILSQPVTLDDHI 273
            ||....:.|:.|......::   |:... :|:.:.:||.|. ..:.:.|.|||.|..|:. ....
Mouse   120 SLNPSFYHVKVGGLTLSLLE---PHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLR-PSQF 180

  Fly   274 NVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQT--RLRGTRLGPK 336
            ..:|||.......||..|:.||||......:   :|:::.:.:|:::...|:.  ..:|:.|..:
Mouse   181 TPVCLPAAQTPLTPGTVCWVTGWGATQERDM---ASVLQELAVPLLDSEDCEKMYHTQGSSLSGE 242

  Fly   337 FALDRSFICAG---GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVPAAYAN 397
            ..:....:|||   ||:  |:||||.|.||.|    :..|.:.|.||.:||||| ....|..|..
Mouse   243 RIIQSDMLCAGYVEGQK--DSCQGDSGGPLVC----SINSSWTQVGITSWGIGCARPYRPGVYTR 301

  Fly   398 VALVRGWIDQQMLTN 412
            |.....||.:.:..|
Mouse   302 VPTYVDWIQRILAEN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 78/250 (31%)
Tryp_SPc 169..405 CDD:214473 75/244 (31%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.