DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:286 Identity:83/286 - (29%)
Similarity:117/286 - (40%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GCG---VRNTGGLDFTLSGVSQNEAGFGEFPWTVAL----LHSGNLSYFCAGSLIHKQVVLTAAH 207
            |||   |.:.|.     ..|..:.|..|.:||..:|    :|      .|.|||:..:.||||||
  Rat    17 GCGQPQVSHAGS-----RIVGGHAAQAGAWPWQASLRLQKVH------VCGGSLLSPEWVLTAAH 70

  Fly   208 CVE-SLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYN--RRSIAY-----------DF 258
            |.. |:.:..:.|..||                 .|:.|.|.::  ::.|.|           |.
  Rat    71 CFSGSVNSSDYEVHLGE-----------------LTITLSPHFSTVKQIIMYSSAPGPPGSSGDI 118

  Fly   259 ALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNS 323
            |||.|:.||.|...:..:|||:......||..|:.||||....|...|....::...:.:|:..:
  Rat   119 ALVQLATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVET 183

  Fly   324 CQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC- 387
            |......:. |.....|  .:||.|..  |.||.|.|.||.|.....    :||.|:|:||.|| 
  Rat   184 CSQAYSSSN-GSLIQSD--MLCAWGPG--DACQDDSGGPLVCRVAGI----WQQAGVVSWGEGCG 239

  Fly   388 NDEVPAAYANVALVRGWIDQQMLTNG 413
            ..:.|..||.|.....||.:.:|..|
  Rat   240 RPDRPGVYARVTAYVNWIHRHILEPG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 76/260 (29%)
Tryp_SPc 169..405 CDD:214473 73/254 (29%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 74/259 (29%)
Tryp_SPc 30..260 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346351
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.