DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Prss29

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:88/275 - (32%)
Similarity:132/275 - (48%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DFTLSGVSQNEAGFGEFPWTVAL-LHSGNLS---YFCAGSLIHKQVVLTAAHCVES--------- 211
            |..:..|..|.|..|::||.|:| ::..|.:   :.|.||:||.|.|||||||:..         
  Rat    26 DVLVGIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFR 90

  Fly   212 LRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVI 276
            :..|...:..||   :.:|         |..||:|||:.|..:..|.||:.|:|.|....::..:
  Rat    91 IYLGQVYLYGGE---KLLK---------VSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPV 143

  Fly   277 CL-PQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSL-----MKRVPLPIVEFNSCQTRLR-GTRL- 333
            .| |...::.:. :.|:.|||     ||:..:.||     :::|.:.||:...|:...| .||| 
  Rat   144 KLSPASLEVTKK-DVCWVTGW-----GSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLS 202

  Fly   334 --GPKFALDRSFICAGGQRGIDTCQGDGGAPLAC-PRGSTRESRYQQTGIVAWGIGCN-DEVPAA 394
              |.:..| :..:|| |..|.|:|.||.|.||.| ..||     :...|:|:||.||. .::|..
  Rat   203 NHGQRLIL-QDMLCA-GSHGRDSCYGDSGGPLVCNVTGS-----WTLVGVVSWGYGCALKDIPGV 260

  Fly   395 YANVALVRGWIDQQM 409
            ||.|.....||..||
  Rat   261 YARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 85/266 (32%)
Tryp_SPc 169..405 CDD:214473 82/260 (32%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.