DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG30289

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:283 Identity:88/283 - (31%)
Similarity:130/283 - (45%) Gaps:74/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GVSQNEAG----FG-------EFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFT 218
            |:|:::..    ||       |.||.|.:..|..    |.||||.:|.||||||||      ||.
  Fly    31 GISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP----CGGSLIARQFVLTAAHCV------SFE 85

  Fly   219 ---VRAGEWDTQTMKERLPY----------QERSVQTVILHPDYNRRSIAYDFALVILSQPVTLD 270
               ||.|:::|   .:.:||          ...||...|:|.:||..::..|.||:.:|:.|...
  Fly    86 DLYVRLGDYET---LDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYS 147

  Fly   271 DHINVICL---PQQDDIPQPGNTCFS-TGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGT 331
            |::..|||   .|...||.     |: ||||:..:   |::|.::....|..::.:.|..:..  
  Fly   148 DYVRPICLLVGEQMQSIPM-----FTVTGWGETEY---GQFSRILLNATLYNMDISYCNIKFN-- 202

  Fly   332 RLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQ--------QTGIVAWGI-GC 387
                |.| |||.||||.... :||:||.|.||:        |::.        |.|:|::|. .|
  Fly   203 ----KQA-DRSQICAGSHTS-NTCKGDSGGPLS--------SKFHYGNRLLSFQYGLVSYGSERC 253

  Fly   388 NDEVPAAYANVALVRGWIDQQML 410
            ...|...|.||:..|.||..:|:
  Fly   254 AANVAGVYTNVSYHREWIFNKMV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 86/278 (31%)
Tryp_SPc 169..405 CDD:214473 83/272 (31%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 83/265 (31%)
Tryp_SPc 42..271 CDD:238113 83/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.