DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG30288

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:112/282 - (39%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 CGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTG 215
            ||..::.|....:.|  ..:||....||.|.::.||..  .|.||||..:.||||.||:..:   
  Fly    31 CGTTSSNGYRARIDG--GRDAGMESNPWMVRVMISGKA--VCGGSLITARFVLTAEHCISPM--- 88

  Fly   216 SFTVRAGEWDTQTMKERLPYQERSVQTVILHP----------------DYNRRSI----AYDFAL 260
            ...||.||:||:                  ||                |.:|:.:    .||..|
  Fly    89 YMNVRLGEYDTR------------------HPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGL 135

  Fly   261 VILSQPVTLDDHINVICLPQQDDIPQPGNTCFS------TGWGKDAFGSLGKYSSLMKRVPLPIV 319
            :.:.:.|...:::..|||.....:   |....|      ||||.:   |.|:....::...|..:
  Fly   136 LRMQRSVIFSNYVRPICLILGKTL---GGNPLSILRFNFTGWGTN---SDGEEQDRLQTATLQQL 194

  Fly   320 EFNSCQTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWG 384
            ...||:.        |...||.|:||||.... |:|:||.|.||:..|....:.|..|.|:.:.|
  Fly   195 PQWSCER--------PGRPLDISYICAGSYIS-DSCKGDSGGPLSAIRTFEGQGRVFQFGVASQG 250

  Fly   385 IG-CNDEVPAAYANVALVRGWI 405
            :. |:.  ...|.||.....||
  Fly   251 LRLCSG--LGIYTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 72/267 (27%)
Tryp_SPc 169..405 CDD:214473 70/262 (27%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 71/269 (26%)
Tryp_SPc 45..270 CDD:238113 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.