DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG30082

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:275 Identity:92/275 - (33%)
Similarity:124/275 - (45%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 PNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCV 209
            ||    ||  .|..|..|...|....|..|..|| :|.||. |.|..|.|:||.|:.|||||||:
  Fly    26 PN----CG--TTINLPPTNRIVGGRTADIGSNPW-LAYLHK-NSSLVCTGTLITKRFVLTAAHCL 82

  Fly   210 ESLRTGSFTVRAGEWDTQTMKE-----RLP-YQERSVQTVILHPDY-NRRSIAYDFALVILSQPV 267
            .|...  .|||.||:||.|..:     .:| |:|.||:...:|..: .|:....|..|:.|:..|
  Fly    83 HSFHL--LTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTV 145

  Fly   268 TLDDHINVICLPQQDDIPQPGNTCFST-----GWGK-DAFGSLGKYSSLMKRVPLPIVEFNSCQT 326
            .....|..|||     ...||...:|:     |||| |...:    :::::.|.|..::.:.|:.
  Fly   146 VYKLFIRPICL-----FRDPGQVPYSSTYEAAGWGKIDLINT----ATVLQTVNLIRLDQSDCER 201

  Fly   327 RLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWG-IGCNDE 390
            .||       .:|.....|||..|. |||.||.|.||:....:.|.:|..|.|||::| ..|.. 
  Fly   202 SLR-------TSLSYGQFCAGQWRA-DTCSGDSGGPLSRKMSNGRITRTVQLGIVSYGHYLCRG- 257

  Fly   391 VPAAYANVALVRGWI 405
             |..|..|.....||
  Fly   258 -PGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 85/254 (33%)
Tryp_SPc 169..405 CDD:214473 82/249 (33%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 83/254 (33%)
Tryp_SPc 40..274 CDD:238113 85/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.