DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and TPSD1

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:220 Identity:77/220 - (35%)
Similarity:106/220 - (48%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VSQNEAGFGEFPWTVALLHSGNL-SYFCAGSLIHKQVVLTAAHCVE-------SLRTGSFTVRAG 222
            |...||...::||.|:|...|.. .:||.|||||.|.|||||||||       :||         
Human    39 VGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALR--------- 94

  Fly   223 EWDTQTMKERLPYQER--SVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIP 285
               .|..::.|.||::  .|..:|:||.:.......|.||:.|.:||.:..||:.:.||...:..
Human    95 ---VQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETF 156

  Fly   286 QPGNTCFSTGWGKDAFGSL---GKYSSLMKRVPLPIVEFNSCQTRLR-GTRLGPKFALDR-SFIC 345
            .||..|:.|||| |...::   ..|.  :|.|.:|:||.:.|..... |...|..|.:.| ..:|
Human   157 PPGMPCWVTGWG-DVDNNVHLPPPYP--LKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLC 218

  Fly   346 AGGQRGIDTCQGDGGAPLACPRGST 370
            ||.:.. |:||||.|.||.|....|
Human   219 AGSENH-DSCQGDSGGPLVCKVNGT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 77/220 (35%)
Tryp_SPc 169..405 CDD:214473 76/217 (35%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 76/218 (35%)
Tryp_SPc 38..240 CDD:214473 76/216 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.