DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and try-1

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:286 Identity:95/286 - (33%)
Similarity:133/286 - (46%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GCGVRNTG----------------GLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYF-CAGSLI 197
            |||:.:|.                .||..|.|.|  |:....:||||.||  ..|.:. |.||||
 Worm    29 GCGLHSTNVELAQTRSAQEPADYVTLDHRLIGGS--ESSPHSWPWTVQLL--SRLGHHRCGGSLI 89

  Fly   198 HKQVVLTAAHC-VESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYN-RRSIAYDFAL 260
            ....||||||| .:..|..|::||.|...:.:..   |::   |..|.:||.|| ....:||||:
 Worm    90 DPNFVLTAAHCFAKDRRPTSYSVRVGGHRSGSGS---PHR---VTAVSIHPWYNIGFPSSYDFAI 148

  Fly   261 VILSQPVTLDDHINVICLPQQDDIPQPGN-TCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSC 324
            :.:..||........||||   .:|...| .|..||||....|| ...:..::.:.:|::....|
 Worm   149 MRIHPPVNTSTTARPICLP---SLPAVENRLCVVTGWGSTIEGS-SLSAPTLREIHVPLLSTLFC 209

  Fly   325 QTRLRGTRLGPKFALDR----SFICAGGQRG-IDTCQGDGGAPLACPRGSTRESRYQQTGIVAWG 384
            .:.       |.: :.|    |.:|||...| ||:||||.|.||.|    .|:..::.||:|:||
 Worm   210 SSL-------PNY-IGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMC----ARDGHWELTGVVSWG 262

  Fly   385 IGC-NDEVPAAYANVALVRGWIDQQM 409
            ||| ...:|..|.||.....||:.:|
 Worm   263 IGCARPGMPGVYGNVHSASTWINLEM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 86/251 (34%)
Tryp_SPc 169..405 CDD:214473 83/245 (34%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 86/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.