DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:279 Identity:92/279 - (32%)
Similarity:126/279 - (45%) Gaps:44/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 PTPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNL-SYFCAGSLIHKQV 201
            |.|.:||        |...||          :||...::||.|:|....|. .:||.|||||.|.
Mouse    23 PRPANQR--------VGIVGG----------HEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQW 69

  Fly   202 VLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQER--SVQTVILHPDYNRRSIAYDFALVILS 264
            ||||||||     |........:..|..::.|.|.::  |:..:::||.|.......|.||:.|.
Mouse    70 VLTAAHCV-----GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELE 129

  Fly   265 QPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSL-----MKRVPLPIVEFNSC 324
            .||.:..|::.|.||...:...||.:|:.|||     |.:.....|     :|:|.:||||.:.|
Mouse   130 VPVNVSTHLHPISLPPASETFPPGTSCWVTGW-----GDIDNDEPLPPPYPLKQVKVPIVENSLC 189

  Fly   325 QTRLR-GTRLGPKFAL-DRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC 387
            ..:.. |...|..|.: ....:|||..|. |:||||.|.||.|....|    :.|.|:|:||.||
Mouse   190 DRKYHTGLYTGDDFPIVHDGMLCAGNTRR-DSCQGDSGGPLVCKVKGT----WLQAGVVSWGEGC 249

  Fly   388 -NDEVPAAYANVALVRGWI 405
             ....|..|..|.....||
Mouse   250 AQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 85/251 (34%)
Tryp_SPc 169..405 CDD:214473 83/246 (34%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 87/262 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.