DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and CG12256

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:269 Identity:75/269 - (27%)
Similarity:122/269 - (45%) Gaps:43/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RNTGGLDFTLSGVSQNEAGFGEFPWTVA---LLHSGNLSYFCAGSLIHKQVVLTAAHCVESLRTG 215
            |..||.|     |.::|    ..|:.|:   |..||.:.:||.||||....||||||||......
  Fly    46 RVVGGYD-----VPEDE----YVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNAS 101

  Fly   216 SFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDD-HINVICLP 279
            ..:|.||..|   :.:...::.: ||:..::.:| :..:..|.|::.:..|..||: .::.|.:.
  Fly   102 RISVVAGIRD---LNDSSGFRSQ-VQSYEMNENY-QELVTSDIAILKIDPPFELDEKRVSTIDVS 161

  Fly   280 QQDDIPQPGNTCFSTGWGKDAF----GSLGKYSSLMKRVPLPIVEFNSCQ---TRLRGTRLGPKF 337
            ..|.:........ |||| ..|    |...||.::::::....:..:.|:   |:|..|.     
  Fly   162 GSDMVGADQEVLL-TGWG-SVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMTQLTDTE----- 219

  Fly   338 ALDRSFICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIG-CNDEVPAAYANVALV 401
                  |||..:.|...|.||.|.||....|.:    |:|.|:|::|.. |....|..|..|::.
  Fly   220 ------ICALERFGKGACNGDSGGPLVMKSGES----YKQVGVVSYGTAFCASNNPDVYTRVSMF 274

  Fly   402 RGWIDQQML 410
            .|||.::|:
  Fly   275 DGWIKERMV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 70/253 (28%)
Tryp_SPc 169..405 CDD:214473 67/247 (27%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 72/262 (27%)
Tryp_SPc 47..280 CDD:238113 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.