DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Prss29

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:288 Identity:94/288 - (32%)
Similarity:134/288 - (46%) Gaps:53/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GCGVRNT--GGLDFTLSG-VSQNEAGFGEFPWTVAL----------LHSGNLSYFCAGSLIHKQV 201
            ||.:..|  .|.:..|.| |..:.|..|::||.|:|          :|:      |.||:||.|.
Mouse    13 GCSIAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHN------CGGSIIHPQW 71

  Fly   202 VLTAAHCV--ESLRTGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILS 264
            |||||||:  .......|.:|.||......||.|     ||..||:|||:....:..|.||:.|:
Mouse    72 VLTAAHCIRERDADPSVFRIRVGEAYLYGGKELL-----SVSRVIIHPDFVHAGLGSDVALLQLA 131

  Fly   265 QPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSL-----MKRVPLPIVEFNSC 324
            ..|....::..:.||.:.......:.|:.|||     |::..:.||     :::|.:.|::.:.|
Mouse   132 VSVQSFPNVKPVKLPSESLEVTKKDVCWVTGW-----GAVSTHRSLPPPYRLQQVQVKIIDNSLC 191

  Fly   325 Q------TRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLAC-PRGSTRESRYQQTGIVA 382
            :      ||.|..  |.|..| :..:|||.| |.|:|.||.|.||.| ..||     :...|:|:
Mouse   192 EEMYHNATRHRNR--GQKLIL-KDMLCAGNQ-GQDSCYGDSGGPLVCNVTGS-----WTLVGVVS 247

  Fly   383 WGIGCN-DEVPAAYANVALVRGWIDQQM 409
            ||.||. .:.|..||.|.....||.|||
Mouse   248 WGYGCALRDFPGVYARVQSFLPWITQQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 85/266 (32%)
Tryp_SPc 169..405 CDD:214473 82/260 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 85/267 (32%)
Tryp_SPc 31..271 CDD:214473 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842911
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.