DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Prss28

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:255 Identity:74/255 - (29%)
Similarity:126/255 - (49%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 GEFPWTVAL-LHSGNLS---YFCAGSLIHKQVVLTAAHCVES--LRTGSFTVRAGEWDTQTMKER 232
            |::||.|:| ::|..::   :.|.||:||.|.:||||||::|  .....:.|:.||......:|.
Mouse    40 GKWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQEL 104

  Fly   233 LPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWG 297
            |     ::..:|:|||||..|..:|.||:.|:..:....:::.:.||:........:.|:..|||
Mouse   105 L-----NISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWG 164

  Fly   298 KDAFGSLGKYSSLMKRVPL-----------PIVEFNSCQT--RLRGTRLGPKFALDRSFICAGGQ 349
                       :|::||||           ||.:..||:.  |.:.:......|:....:|| |.
Mouse   165 -----------NLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVAIFDDMLCA-GT 217

  Fly   350 RGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDEVPAAYANVALVRGWIDQQM 409
            .|...|.||.|.||.|    .:.:::.|.|:|:.||.|::.:|:.::.|.....||.|.:
Mouse   218 SGRGPCFGDSGGPLVC----WKSNKWIQVGVVSKGIDCSNNLPSIFSRVQSSLAWIHQHI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 73/252 (29%)
Tryp_SPc 169..405 CDD:214473 71/249 (29%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 73/252 (29%)
Tryp_SPc 31..269 CDD:214473 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.