DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Ctrl

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:266 Identity:92/266 - (34%)
Similarity:135/266 - (50%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GCGV-RNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVESLR 213
            |||| ..|..|.:....|:...|..|.:||.|:|..:... :||.||||....|:|||||  .:.
Mouse    18 GCGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGF-HFCGGSLISPNWVVTAAHC--QVT 79

  Fly   214 TGSFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICL 278
            .|...|..||:|..:..|  |.|..|:...|.||::|..::..|..|:.|:.|......::.:||
Mouse    80 PGRHFVVLGEYDRSSNAE--PVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCL 142

  Fly   279 PQQDDIPQPGNTCFSTGWGKDAFGSLGKYS-SLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRS 342
            ...::....|.||.:||||:  ...:|..: :.:::|.||:|..|.|: :..|.|      :..:
Mouse   143 ASTNEALPSGLTCVTTGWGR--ISGVGNVTPARLQQVVLPLVTVNQCR-QYWGAR------ITDA 198

  Fly   343 FICAGGQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGI-GCNDEVPAAYANVALVRGWID 406
            .|||||. |..:||||.|.||.|.:|:|    :...|||:||. .||.:.||.|..|:....||:
Mouse   199 MICAGGS-GASSCQGDSGGPLVCQKGNT----WVLIGIVSWGTKNCNIQAPAMYTRVSKFSTWIN 258

  Fly   407 QQMLTN 412
            |.|..|
Mouse   259 QVMAYN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 83/243 (34%)
Tryp_SPc 169..405 CDD:214473 80/237 (34%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 81/242 (33%)
Tryp_SPc 34..260 CDD:238113 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12541
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.