DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and PRSS21

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:273 Identity:83/273 - (30%)
Similarity:114/273 - (41%) Gaps:51/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VSQNEAGFGEFPWTVALLHSGNL----SYFCAGSLIHKQVVLTAAHCVES-----------LRTG 215
            |...:|..|.:||      .|:|    |:.|..||:..:..||||||.|:           ::.|
Human    43 VGGEDAELGRWPW------QGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFG 101

  Fly   216 SFTVRAGEWDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQ 280
            ..|.....|..|..     |....|..:.|.|.|...| .||.|||.||.|||...||..|||..
Human   102 QLTSMPSFWSLQAY-----YTRYFVSNIYLSPRYLGNS-PYDIALVKLSAPVTYTKHIQPICLQA 160

  Fly   281 QDDIPQPGNTCFSTGWG----KDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDR 341
            .....:....|:.||||    .:|..|    ...::.|.:.|:..:.|      ..|..|::..:
Human   161 STFEFENRTDCWVTGWGYIKEDEALPS----PHTLQEVQVAIINNSMC------NHLFLKYSFRK 215

  Fly   342 ----SFICAG-GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVPAAYANVAL 400
                ..:||| .|.|.|.|.||.|.||||    .:...:.|.|:|:||:|| ....|..|.|::.
Human   216 DIFGDMVCAGNAQGGKDACFGDSGGPLAC----NKNGLWYQIGVVSWGVGCGRPNRPGVYTNISH 276

  Fly   401 VRGWIDQQMLTNG 413
            ...||.:.|..:|
Human   277 HFEWIQKLMAQSG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 81/266 (30%)
Tryp_SPc 169..405 CDD:214473 78/260 (30%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 81/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.