DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and Prss48

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:260 Identity:72/260 - (27%)
Similarity:117/260 - (45%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 AGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVE--------SLRTGSFTVRAGEWDTQ 227
            |..|.:||.|:|....  ::.|.||||....|:|||||::        |:..||.     :.|..
  Rat    46 AALGHWPWQVSLRFDS--THICGGSLISNHWVMTAAHCIKKTWFSFLYSVWLGSI-----DRDYS 103

  Fly   228 TMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQP---GN 289
            :..|     |..|..:::...::...  .|.||:.||..||....:..||||   :|.:|   ..
  Rat   104 STGE-----EYYVSRIVIPSKHHNTD--GDIALLKLSSRVTFTSLVLPICLP---NISKPLTVPA 158

  Fly   290 TCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQ-------------TRLRGTRLGPKFALDR 341
            :|:.||||::   ..|.|.|.::.:.:||:...:|:             .|:          :..
  Rat   159 SCWVTGWGQN---QEGHYPSTLQELEVPIITGEACEQLYNPIGFFLPDLERI----------IKE 210

  Fly   342 SFICAGG-QRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDEVPAAYANVALVRGWI 405
            ..:|||. |:..|:|:||.|.||:|    ..:..:.|.|:::||:.|...:|..|.||...:.||
  Rat   211 DMLCAGEIQQSKDSCKGDSGGPLSC----HIDGVWTQIGVISWGLECGKNLPGVYTNVTYYQKWI 271

  Fly   406  405
              Rat   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 72/260 (28%)
Tryp_SPc 169..405 CDD:214473 70/258 (27%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.