DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and cela1.2

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:240 Identity:83/240 - (34%)
Similarity:128/240 - (53%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 FPWTVALLHS--GNLSYFCAGSLIHKQVVLTAAHCVESLRTGSFTVRAGEWDTQTMKERLPYQER 238
            :||.::|.:|  |...|:|:|:||....|:.||||||:||  .:||..|:.|..|.:.  |.|..
Zfish    41 WPWQISLQYSDLGTYYYYCSGTLIRPGWVMVAAHCVEALR--KWTVALGDHDIYTHEG--PEQYI 101

  Fly   239 SVQTVILHPDYNRRSIA--YDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAF 301
            ||..|.:||::|..::|  ||.||:.||...||..::.|..||...:|...|:||:.||||....
Zfish   102 SVSEVFIHPNWNPNNVAFGYDIALLRLSIDATLSSYVQVATLPSSGEILPYGHTCYITGWGYTET 166

  Fly   302 GSLGKYSSLMKRVPLPIVEFNSC-QTRLRGTRLGPKFALDRSFICAGGQRGIDTCQGDGGAPLAC 365
            |  |..|:.:|:..:|:|::.:| |....|:      ::..:.|||||...:..|.||.|:||.|
Zfish   167 G--GSLSAQLKQAYMPVVDYETCSQKDWWGS------SVKETMICAGGTTSMSACHGDSGSPLNC 223

  Fly   366 PRGSTRESRYQQTGIVAW--GIGCND-EVPAAYANVALVRGWIDQ 407
                ....:|...|:.::  ..|||. :.|..:..|:....||:|
Zfish   224 ----LFNGKYVVHGVTSFVSPEGCNTYKKPTGFTRVSAYINWINQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 83/240 (35%)
Tryp_SPc 169..405 CDD:214473 80/236 (34%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 80/236 (34%)
Tryp_SPc 30..265 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H133791
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.