DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and zgc:165423

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:285 Identity:97/285 - (34%)
Similarity:132/285 - (46%) Gaps:39/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TLNPTPLDQRPNQ-PRGCG-----VRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCA 193
            ||..|..|.:|.| |..||     .:..||          ..|..|.:||..:|..||  |:||.
Zfish    12 TLLSTGCDCQPTQSPPACGKAPLNTKIVGG----------TNASAGSWPWQASLHESG--SHFCG 64

  Fly   194 GSLIHKQVVLTAAHCVESLRTGS-FTVRAGEWDTQTMKERLPYQ---ERSVQTVILHPDYNRRSI 254
            ||||..|.:|:||||..|....| :||..|.     ..:.||..   .:||..||:||.|...:.
Zfish    65 GSLISDQWILSAAHCFPSNPNPSDYTVYLGR-----QSQDLPNPNEVSKSVSQVIVHPLYQGSTH 124

  Fly   255 AYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIV 319
            ..|.||:.||.|||..::|..:|| ..|......:|.:.||||....|.......:::.|.:|||
Zfish   125 DNDMALLHLSSPVTFSNYIQPVCL-AADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIV 188

  Fly   320 EFNSCQTRLRGTRLGPKFALDRSFICAG-GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAW 383
            ..|.|.....|..     ::..:.:||| .|.|.|:||||.|.|:.....:|    :.|.|:|::
Zfish   189 GNNLCNCLYGGGS-----SITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFNT----WVQAGVVSF 244

  Fly   384 GIGCND-EVPAAYANVALVRGWIDQ 407
            |.||.| ..|..||.|:..:.||.|
Zfish   245 GKGCADPNYPGVYARVSQYQNWISQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 86/248 (35%)
Tryp_SPc 169..405 CDD:214473 83/241 (34%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 85/256 (33%)
Tryp_SPc 38..269 CDD:238113 87/257 (34%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.