DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG40160 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:267 Identity:85/267 - (31%)
Similarity:125/267 - (46%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 GVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHCVES-LRTG 215
            |.|..||:          ||..|.:||.|. :..|:..:.|.||:|.|..||:||||..: ....
Zfish    29 GKRIVGGV----------EASPGSWPWQVD-IQMGSNGHVCGGSIIAKNWVLSAAHCFPNPSEVS 82

  Fly   216 SFTVRAGE--WDTQTMKERLPYQERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICL 278
            ::|:..|.  .:.....|::.|    ||.|::...|.......|.|||.|..||:..|.|..:||
Zfish    83 AYTLYMGRHLLNGYNQFEKVSY----VQRVVIPEGYTDPQGGRDVALVQLRAPVSWTDRIQPVCL 143

  Fly   279 PQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDRS- 342
            |..|.....|..|:.||||....|.....::.::.|.:||::.:|||...:      ..:.|.| 
Zfish   144 PFADFQFNSGTLCYVTGWGHKQEGVSLTGAAALREVEVPIIDQSSCQFMYQ------ILSSDSST 202

  Fly   343 ------FICAG-GQRGIDTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGC-NDEVPAAYANVA 399
                  .|||| .:.|.|:||||.|.||.||.|:   ..:.|.|:|::|:|| ....|..|:.|:
Zfish   203 VDILSDMICAGYKEGGKDSCQGDSGGPLVCPVGN---GTWIQAGVVSFGLGCAQKNRPGIYSRVS 264

  Fly   400 ----LVR 402
                |:|
Zfish   265 SFEKLIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 81/253 (32%)
Tryp_SPc 169..405 CDD:214473 81/250 (32%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 83/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.