powered by:
Protein Alignment l(3)80Fg and JEM1
DIOPT Version :9
Sequence 1: | NP_001015187.2 |
Gene: | l(3)80Fg / 3354941 |
FlyBaseID: | FBgn0287183 |
Length: | 780 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_012462.3 |
Gene: | JEM1 / 853372 |
SGDID: | S000003609 |
Length: | 645 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 68 |
Identity: | 30/68 - (44%) |
Similarity: | 43/68 - (63%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYG------AEKFIQIKLAYEILADLDRRR 88
|.|.|||::..|::.|||:||..|.||:||||:|.::. .|...||..|||.|:|.|:|:
Yeast 538 DYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDDKRK 602
Fly 89 IFD 91
.:|
Yeast 603 EYD 605
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0715 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.