DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and MDJ1

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_116638.1 Gene:MDJ1 / 850530 SGDID:S000001878 Length:511 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:45/132 - (34%)
Similarity:65/132 - (49%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TSYIHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILAD 83
            ||.|....:..|||..||:.|.||..||::||.:||||:|||..|.....:||..::.|||||:|
Yeast    50 TSAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEKKFHDLQNAYEILSD 114

  Fly    84 LDRRRIFDRYGV-----------------SDINSQYFQKKHDYSEY-----NRFTLNQNDDDFGQ 126
            ..:|:.:|::|.                 |...||:    ||:|.:     :.|.....:|.||.
Yeast   115 ETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF----HDFSGFTSAGGSPFGGINFEDLFGA 175

  Fly   127 RF 128
            .|
Yeast   176 AF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 30/63 (48%)
DnaJ 30..91 CDD:278647 29/60 (48%)
TRX_DnaJ 134..244 CDD:239261
MDJ1NP_116638.1 DnaJ 60..456 CDD:223560 42/122 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.