DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnaja3

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_076135.3 Gene:Dnaja3 / 83945 MGIID:1933786 Length:480 Species:Mus musculus


Alignment Length:223 Identity:64/223 - (28%)
Similarity:102/223 - (45%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCTTSYIHVCSSL--NDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA-EKFIQIKLA 77
            :||||: |..:||  :|.|.|||:.:.|:..:|::||.:||||:|||..|:|..| |||.|:..|
Mouse    78 VCTTSF-HTSASLAKDDYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEA 141

  Fly    78 YEILADLDRRRIFDRYGVSDIN-------------------SQYFQKKHDYSEYNRFTLNQNDDD 123
            ||:|:|..:|:.:|.||.:..:                   .:.|:|  .:.|::.....    |
Mouse   142 YEVLSDEVKRKQYDAYGSAGFDPGTSSSGQGYWRGGPSVDPEELFRK--IFGEFSSSPFG----D 200

  Fly   124 FGQRFDIKQDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYN--DWCFKCT-RIVDAFKKILEL 185
            |...||..|:            |..::..::.||.|:.....|  |.|.:|. :..:...|:...
Mouse   201 FQNVFDQPQE------------YIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGTKVQHC 253

  Fly   186 LQPIGINFATVNA--VHEESVFRKCGAR 211
            ....|....|:|.  ....|..|:||.|
Mouse   254 HYCGGSGMETINTGPFVMRSTCRRCGGR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 30/64 (47%)
DnaJ 30..91 CDD:278647 29/61 (48%)
TRX_DnaJ 134..244 CDD:239261 17/83 (20%)
Dnaja3NP_076135.3 DnaJ 90..480 CDD:223560 57/210 (27%)
DnaJ 93..155 CDD:278647 29/61 (48%)
DnaJ_C 207..416 CDD:199909 18/87 (21%)
DnaJ_zf 236..296 CDD:199908 11/46 (24%)
CXXCXGXG motif 236..243 2/6 (33%)
CXXCXGXG motif 253..260 1/6 (17%)
CXXCXGXG motif 275..282 4/7 (57%)
CXXCXGXG motif 289..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.