Sequence 1: | NP_001015187.2 | Gene: | l(3)80Fg / 3354941 | FlyBaseID: | FBgn0287183 | Length: | 780 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026893.1 | Gene: | DNAJB14 / 79982 | HGNCID: | 25881 | Length: | 379 | Species: | Homo sapiens |
Alignment Length: | 296 | Identity: | 56/296 - (18%) |
---|---|---|---|
Similarity: | 97/296 - (32%) | Gaps: | 128/296 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 IHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDR 86
Fly 87 RRIFDRYG--------------------VSDIN----------------------------SQYF 103
Fly 104 QKKHD----------------------------------------YSEYNRF----TLNQNDDDF 124
Fly 125 GQRFDIKQDIAFYQKLSITENYFEKMILSKNAKKV---HVVMFYNDWCFKCTRIVDAFKKILELL 186
Fly 187 QPIGINFATVNAVHEESVFRKCGAREVPQLVLILDN 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)80Fg | NP_001015187.2 | DnaJ | 30..>94 | CDD:223560 | 21/63 (33%) |
DnaJ | 30..91 | CDD:278647 | 20/60 (33%) | ||
TRX_DnaJ | 134..244 | CDD:239261 | 19/92 (21%) | ||
DNAJB14 | NP_001026893.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 55..94 | ||
DnaJ | 107..>214 | CDD:223560 | 24/109 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 219..241 | 4/21 (19%) | |||
DUF1977 | 271..371 | CDD:370429 | 26/125 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |