DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc5ab

DIOPT Version :10

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_001338363.1 Gene:dnajc5ab / 797907 ZFINID:ZDB-GENE-081021-2 Length:199 Species:Danio rerio


Alignment Length:64 Identity:27/64 - (42%)
Similarity:43/64 - (67%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.:||:.|.....:|:::|::||.|:|||| ..|...|:||.:|..|:.||:|..:|.|:|:||
Zfish    18 YVVLGVEKNTAQEDIKKSYRKLALKFHPDKNPNNPEAADKFKEINNAHAILSDPTKRNIYDKYG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:440252 25/62 (40%)
TRX_DnaJ 134..244 CDD:239261
dnajc5abXP_001338363.1 PRK10767 18..>81 CDD:236757 25/62 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.