powered by:
Protein Alignment l(3)80Fg and dnajc12
DIOPT Version :9
Sequence 1: | NP_001015187.2 |
Gene: | l(3)80Fg / 3354941 |
FlyBaseID: | FBgn0287183 |
Length: | 780 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001314717.1 |
Gene: | dnajc12 / 797196 |
ZFINID: | ZDB-GENE-070801-3 |
Length: | 165 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 25/72 - (34%) |
Similarity: | 41/72 - (56%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 LNDPYAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFD 91
|.|.|.:||.::.:||.:|...:|..|...|||| .:|....|:|.:::.|.|:|.|..:|:.:|
Zfish 12 LEDYYGLLGCDELSTTEQIVNEFKVKALACHPDKHPENPKAVEQFQKLQEAKEVLTDEKKRKSYD 76
Fly 92 RYGVSDI 98
.:..|.|
Zfish 77 LWLRSQI 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170592342 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.