DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc14

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001346753.1 Gene:Dnajc14 / 74330 MGIID:1921580 Length:703 Species:Mus musculus


Alignment Length:149 Identity:31/149 - (20%)
Similarity:66/149 - (44%) Gaps:29/149 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            :|:.:||:...|:..|:::||::||...||||..:....|.|..::.|::|:::.:||:      
Mouse   444 NPFHVLGVEATASDTELKKAYRQLAVMVHPDKNHHPRAEEAFKILRAAWDIVSNPERRK------ 502

  Fly    95 VSDINSQYFQKKHDYSEYNRFT---LNQNDDDFGQRFDIKQDIAFYQKLSITENYFEKMILSKNA 156
                  :|..|:...:|.:|..   |::..||..:..:.       ...|..:....:..:.:..
Mouse   503 ------EYEMKRMAENELSRSVNEFLSKLQDDLKEAMNT-------MMCSRCQGKHRRFEMDREP 554

  Fly   157 KKVHVVMFYNDWCFKCTRI 175
            |...       :|.:|.|:
Mouse   555 KSAR-------YCAECNRL 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 19/63 (30%)
DnaJ 30..91 CDD:278647 19/60 (32%)
TRX_DnaJ 134..244 CDD:239261 5/42 (12%)
Dnajc14NP_001346753.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..229
DnaJ 444..505 CDD:365959 19/72 (26%)
Jiv90 533..621 CDD:373372 5/48 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..643
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.