DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajb14

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 / 70604 MGIID:1917854 Length:379 Species:Mus musculus


Alignment Length:73 Identity:24/73 - (32%)
Similarity:44/73 - (60%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDR 86
            |:.|.:.   |.:||:.|.|...::::||::||.|:||||.......:.|.:|..||.:|::.::
Mouse   103 INKCKNY---YEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEK 164

  Fly    87 RRIFDRYG 94
            |:.:|..|
Mouse   165 RKQYDLTG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 21/63 (33%)
DnaJ 30..91 CDD:278647 20/60 (33%)
TRX_DnaJ 134..244 CDD:239261
Dnajb14NP_001028327.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..90
DnaJ 107..>214 CDD:223560 22/69 (32%)
DnaJ 108..169 CDD:278647 20/63 (32%)
DUF1977 271..371 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.