powered by:
Protein Alignment l(3)80Fg and Dnajc3
DIOPT Version :9
Sequence 1: | NP_001015187.2 |
Gene: | l(3)80Fg / 3354941 |
FlyBaseID: | FBgn0287183 |
Length: | 780 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_071568.1 |
Gene: | Dnajc3 / 63880 |
RGDID: | 708518 |
Length: | 504 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 29/70 - (41%) |
Similarity: | 42/70 - (60%) |
Gaps: | 4/70 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 SSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKND----YGAEKFIQIKLAYEILADLDR 86
|...|.|.|||:.:.|...||.:||::||.:||||..::: ...:|||.|..|.|:|:|.:.
Rat 390 SQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQSEEEKKKAEKKFIDIAAAKEVLSDPEM 454
Fly 87 RRIFD 91
||.||
Rat 455 RRKFD 459
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166350630 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.