DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc12

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001029204.1 Gene:Dnajc12 / 619393 RGDID:1591898 Length:198 Species:Rattus norvegicus


Alignment Length:76 Identity:22/76 - (28%)
Similarity:42/76 - (55%) Gaps:1/76 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRY 93
            |.|.:||.::.::..:|...:|..|.:.|||| .:|....|.|.:::.|.|||::.:.|..:|.:
  Rat    14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENSKAVETFQKLQKAKEILSNAESRARYDHW 78

  Fly    94 GVSDINSQYFQ 104
            ..|.::..:.|
  Rat    79 RRSQMSMSFEQ 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 20/64 (31%)
DnaJ 30..91 CDD:278647 19/61 (31%)
TRX_DnaJ 134..244 CDD:239261
Dnajc12NP_001029204.1 DnaJ 14..76 CDD:278647 19/61 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.