DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnaja4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001344804.1 Gene:Dnaja4 / 58233 MGIID:1927638 Length:426 Species:Mus musculus


Alignment Length:436 Identity:103/436 - (23%)
Similarity:160/436 - (36%) Gaps:141/436 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYGVS 96
            |.|||:...|:..||::||::||.|:|||  ||....|||..|..|||:|:|..:|.|:|:.|..
Mouse    37 YDILGVKPSASPEEIKKAYRKLALKYHPD--KNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQ 99

  Fly    97 DI-----NSQYFQKKHD-----YSEYNRFTLNQNDDDFGQRFDIK-QDI--AFYQKLSITENYF- 147
            .|     .|..|....|     :....|.|..:...:...:..:. :|:  ...:||::.:|.. 
Mouse   100 AIKEGGSGSPSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNVIC 164

  Fly   148 -------------EKMILSK-NAKKVHV-------VMFYNDWCFKC----TRI------------ 175
                         ||..|.| ...:||:       |......|.:|    .||            
Mouse   165 EKCEGIGGKKGSVEKCPLCKGRGMQVHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCENCSGA 229

  Fly   176 -VDAFKKILELLQPIGINFATVNAVHEESVFRKCGAREVPQL-----VLILDNQYFLYRDHSFTP 234
             |...|||:|:....|:........|.|      |.:| |:|     :::||.     :|||   
Mouse   230 KVTREKKIIEVHVEKGMKDGQKILFHGE------GDQE-PELDPGDVIIVLDQ-----KDHS--- 279

  Fly   235 QKVVEFIRKKIPFNVFKRIEHDNFNDFLGGWSDNRARALIFEPRSLTRLRYLLTAFEFYDRVAFG 299
                          ||:|                |.:.||.:.:  .:|...|..|:...:....
Mouse   280 --------------VFQR----------------RGQDLIMKMK--IQLSEALCGFKKTIKTLDD 312

  Fly   300 FVNTISKDSSNIITRFKVNTSLDTLILFNEDTTTFTASVCMEEIPNHILVNMVSTNQFL-AFPR- 362
            .|..||..|..:|...      |...:.||....:.|.          |...|...||| .||. 
Mouse   313 RVLVISSKSGEVIKHG------DLKCIRNEGMPIYKAP----------LEKGVMIIQFLVVFPEK 361

  Fly   363 --ISSQNI--MESVCPTEWNRQRKHLCVILITENNRKKDFERVALR 404
              :|.:.:  :|::.|.   ||:     :.||:     |.::|.|:
Mouse   362 QWLSQEKLPQLEALLPP---RQK-----VRITD-----DMDQVELK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 29/61 (48%)
DnaJ 30..91 CDD:278647 28/58 (48%)
TRX_DnaJ 134..244 CDD:239261 31/155 (20%)
Dnaja4NP_001344804.1 DnaJ 15..423 CDD:333066 103/436 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.