DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and dnajc3b

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	NP_571705.1	Gene:	dnajc3b / 58154	ZFINID:	ZDB-GENE-000831-4	Length:	502	Species:	Danio rerio

Alignment Length:	70	Identity:	28/70 - (40%)
Similarity:	43/70 - (61%)	Gaps:	4/70 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 SSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKND----YGAEKFIQIKLAYEILADLDR 86
            |...|.|.|||:::.|...||.:||::||::||||..:::    ...:|||.|..|.|:|.|.:.
Zfish   392 SRKRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSEADKKEAEKKFIDIASAKEVLTDPEM 456

  Fly    87 RRIFD 91
            |:.||
Zfish   457 RQKFD 461

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	27/66 (41%)
		DnaJ	30..91	CDD:278647	25/64 (39%)
		TRX_DnaJ	134..244	CDD:239261
dnajc3b	NP_571705.1	TPR_11	41..107	CDD:290150
		TPR repeat	42..70	CDD:276809
		TPR repeat	75..105	CDD:276809
		TPR_11	77..141	CDD:290150
		TPR repeat	110..137	CDD:276809
		TPR repeat	157..184	CDD:276809
		TPR_11	189..254	CDD:290150
		TPR repeat	190..218	CDD:276809
		TPR repeat	223..253	CDD:276809
		TPR repeat	303..337	CDD:276809
		TPR repeat	342..370	CDD:276809
		TPR	348..375	CDD:197478
		DnaJ	394..>500	CDD:223560	27/68 (40%)
		DnaJ	396..461	CDD:278647	25/64 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170592343
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930