DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajb12

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:262 Identity:52/262 - (19%)
Similarity:110/262 - (41%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.|.|||:::.|:..::::||::||.|:||||.......|.|..|..||.:|::.::|:.:|::|
Mouse   111 DYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFG 175

  Fly    95 VSDINSQYFQKKHDYSEYNR-FTLNQNDDD-----FGQRFDIKQDIAFYQKLSITENYFEKMILS 153
              |..||..:..|.:.:::| |..:.:.:|     ||..|. ..::..|....:...|.::....
Mouse   176 --DDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFP-SSNVHVYSNGRMRYTYQQRQDRR 237

  Fly   154 KNAKKVHVVMFYNDWCFKCTRIVDAFKKILELLQPIGIN-FATVNAVHEESVFRKCGAREVPQLV 217
            .|.....:.:|..........:|.|..:::....|..:: ..:|..:|:.               
Mouse   238 DNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHKR--------------- 287

  Fly   218 LILDNQYFLYRDHSFTPQKVVEFIRKKIPFNVFKRIEHDNFNDFLGG-----WSDNRAR-ALIFE 276
                     ..||......|.:...::...:..|.:|.:..:|::..     |.:.:.: .|::.
Mouse   288 ---------VTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYR 343

  Fly   277 PR 278
            .|
Mouse   344 AR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 23/63 (37%)
DnaJ 30..91 CDD:278647 22/60 (37%)
TRX_DnaJ 134..244 CDD:239261 12/110 (11%)
Dnajb12NP_001361685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..97
DnaJ_bact 111..>237 CDD:274090 36/128 (28%)
DUF1977 269..369 CDD:370429 12/101 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.