DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and Dnajc7

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	XP_030102048.1	Gene:	Dnajc7 / 56354	MGIID:	1928373	Length:	579	Species:	Mus musculus

Alignment Length:	75	Identity:	25/75 - (33%)
Similarity:	41/75 - (54%)	Gaps:	12/75 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 SSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA---------EKFIQIKLAYEIL 81
            |...|.|.|||::|.|:..||::||::.|...|||:   ..||         :||.::..|:.||
Mouse   462 SKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDR---HSGASAEVQKEEEKKFKEVGEAFTIL 523

  Fly    82 ADLDRRRIFD 91
            :|..::..:|
Mouse   524 SDPKKKTRYD 533

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	24/71 (34%)
		DnaJ	30..91	CDD:278647	23/69 (33%)
		TRX_DnaJ	134..244	CDD:239261
Dnajc7	XP_030102048.1	AANH_like	<19..91	CDD:381925
		3a0801s09	104..>438	CDD:273380
		TPR repeat	113..141	CDD:276809
		TPR repeat	146..176	CDD:276809
		TPR repeat	181..209	CDD:276809
		TPR repeat	230..255	CDD:276809
		TPR repeat	260..290	CDD:276809
		TPR repeat	295..323	CDD:276809
		TPR repeat	342..369	CDD:276809
		TPR repeat	374..408	CDD:276809
		TPR repeat	413..441	CDD:276809
		DnaJ	465..>554	CDD:223560	24/72 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167847118
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930