DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and DNAJB12

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	NP_001352009.1	Gene:	DNAJB12 / 54788	HGNCID:	14891	Length:	377	Species:	Homo sapiens

Alignment Length:	100	Identity:	32/100 - (32%)
Similarity:	59/100 - (59%)	Gaps:	3/100 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.|.|||:::.|:..::::||:.||.|:||||.......|.|..|..||.:|::.::|:.:|::|
Human   110 DYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFG 174

  Fly    95 VSDINSQYFQKKHDYSEYNR-FTLNQNDDDFGQRF 128
              |..||..:..|.:.:::| |..:.:.:|....|
Human   175 --DDKSQAARHGHGHGDFHRGFEADISPEDLFNMF 207

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	23/63 (37%)
		DnaJ	30..91	CDD:278647	22/60 (37%)
		TRX_DnaJ	134..244	CDD:239261
DNAJB12	NP_001352009.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	45..92
		DnaJ	110..>236	CDD:333066	31/99 (31%)
		DUF1977	268..368	CDD:312722
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910