DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc25

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001011497.1 Gene:dnajc25 / 496999 XenbaseID:XB-GENE-954361 Length:368 Species:Xenopus tropicalis


Alignment Length:266 Identity:54/266 - (20%)
Similarity:102/266 - (38%) Gaps:90/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVK-----------NDYGAEKFIQIKLA 77
            ||      |.:||:::.|:..:|..||::||:|:|||:.:           .:...|||:.:..|
 Frog    57 VC------YDVLGVSRDASKGDIARAYRQLARKYHPDRYRPGEPPGPDGETRESAQEKFLLVATA 115

  Fly    78 YEILADLDRRRIFDRYGVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRFDIKQDIAFYQKLSI 142
            ||.|.|.:.|:.:|.  :.|...:|:  :|.|..|:|            |...|.|:        
 Frog   116 YETLKDEETRKDYDY--MLDHPEEYY--RHYYHYYSR------------RLAPKVDV-------- 156

  Fly   143 TENYFEKMILSKNAKKVHVVMFYNDW-----CFKCTRIVDAFK-KILELLQPIGI---------N 192
                  ::::..:...:.:..:|:.|     .......|..:: :.:|:.:..|:         |
 Frog   157 ------RIVILVSVCAISIFQYYSWWSSYNEAINYLATVTKYRIQAMEIAKQQGLLNRTKEKGKN 215

  Fly   193 FATVNAV--HEESVFRKC--------GAREVPQLVLILDNQYFLYRDHSFTPQKVVEFIRKKIPF 247
            ..:...:  .||.:.|..        |..:.||:..||..|..|:                  |:
 Frog   216 RRSKEEIKSEEEEIIRDIIKNKIDIKGGYQKPQIFDILLFQIILF------------------PY 262

  Fly   248 NVFKRI 253
            .:||.|
 Frog   263 YIFKYI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 23/74 (31%)
DnaJ 30..91 CDD:278647 22/71 (31%)
TRX_DnaJ 134..244 CDD:239261 16/134 (12%)
dnajc25NP_001011497.1 DnaJ 59..>137 CDD:223560 24/79 (30%)
DnaJ 59..129 CDD:278647 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.