DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001007515.1 Gene:dnajc4 / 493241 XenbaseID:XB-GENE-994193 Length:233 Species:Xenopus tropicalis


Alignment Length:228 Identity:62/228 - (27%)
Similarity:97/228 - (42%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCTTSY-----IHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQI 74
            |||.|.     .|..|...|.|.:|||.:|||:.||:.|:..::||.|||. ..|.....:|:::
 Frog    13 LCTASAQRYAGTHTGSGPRDHYQLLGIERKATSEEIKNAFFTMSKKLHPDSDPTNPLLHSQFVRL 77

  Fly    75 KLAYEILADLDRRRIFDR-----------YGVSDINSQYFQ----------KKHDYSEYNRFTLN 118
            ..||::|:....||.:|:           ||.   .|.|:|          ..|.:|::    ..
 Frog    78 SEAYKVLSRDTSRREYDQLLDAAQRDRWAYGA---RSSYYQGPSPSAAADENAHYWSQF----AA 135

  Fly   119 QNDDDFGQRFDIKQDIAFYQKL----SITENY--FEKM--ILSKNAKKVH--VVMFYNDWCFKCT 173
            :..|...:|......:..|..|    |:|.:|  |:.:  |.|...:|.|  ::..||:  .|..
 Frog   136 RRGDPTQRRQGRNGRLVLYCLLIMAGSLTMHYVGFKTLREIHSNFMEKQHKRILKIYNE--AKER 198

  Fly   174 RIVDAFKKILELLQPIGINFAT---VNAVHEES 203
            ..|:.|:|..|:|:.....|..   ....||||
 Frog   199 ARVNGFRKQQEILREKHAAFTEKYHAKNRHEES 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 24/75 (32%)
DnaJ 30..91 CDD:278647 23/61 (38%)
TRX_DnaJ 134..244 CDD:239261 23/83 (28%)
dnajc4NP_001007515.1 DnaJ 32..94 CDD:278647 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.