DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnaja2

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:153 Identity:44/153 - (28%)
Similarity:73/153 - (47%) Gaps:29/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRY--- 93
            |.|||:...|:..::::||::|||::|||  ||....:||.:|..|||:|::.::|.::|||   
 Frog    10 YDILGVAPGASENDLKKAYRKLAKEYHPD--KNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQ 72

  Fly    94 ---------GVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRFDIKQDIAFYQKLSITENYFEK 149
                     |:.||.|..|.     .....|...|:....|:|..  :|:....|:|:.:.|   
 Frog    73 GLREGSGGSGMDDIFSHIFG-----GGLFGFMGGQSRSRNGRRRG--EDMMHPLKVSLEDLY--- 127

  Fly   150 MILSKNAKKVHVVMFYNDWCFKC 172
                 |.|...:.:..|..|..|
 Frog   128 -----NGKTTKLQLSKNVLCSSC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 26/73 (36%)
DnaJ 30..91 CDD:278647 23/58 (40%)
TRX_DnaJ 134..244 CDD:239261 8/39 (21%)
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 44/153 (29%)
DnaJ 9..67 CDD:278647 23/58 (40%)
DnaJ_C 113..339 CDD:199909 9/41 (22%)
DnaJ_zf 142..208 CDD:199908 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.