Sequence 1: | NP_001015187.2 | Gene: | l(3)80Fg / 3354941 | FlyBaseID: | FBgn0287183 | Length: | 780 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003571.1 | Gene: | dnajb1a / 445177 | ZFINID: | ZDB-GENE-040801-90 | Length: | 335 | Species: | Danio rerio |
Alignment Length: | 249 | Identity: | 62/249 - (24%) |
---|---|---|---|
Similarity: | 102/249 - (40%) | Gaps: | 73/249 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
Fly 95 VSDIN----------------------SQYFQKKHDYSEYNRFTLNQN-----DDDFG------- 125
Fly 126 ----QRF-----------DIKQDIAFYQKLSIT-ENYF----EKMILS-----------KNAKKV 159
Fly 160 HVVMFYNDWCFKCTRIVDAFKKILELLQ---PIGINFATVNAVHEESVFRKCGA 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
l(3)80Fg | NP_001015187.2 | DnaJ | 30..>94 | CDD:223560 | 28/63 (44%) |
DnaJ | 30..91 | CDD:278647 | 26/60 (43%) | ||
TRX_DnaJ | 134..244 | CDD:239261 | 23/96 (24%) | ||
dnajb1a | NP_001003571.1 | DnaJ | 1..335 | CDD:223560 | 62/249 (25%) |
DnaJ | 4..65 | CDD:278647 | 26/60 (43%) | ||
DnaJ_C | 157..321 | CDD:199909 | 23/96 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |