DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajb1a

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:249 Identity:62/249 - (24%)
Similarity:102/249 - (40%) Gaps:73/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.|.||||.|.|:..||::||::.|.::||||.|:....:||.:|..||::|:|..::.|:||||
Zfish     4 DYYRILGIEKGASDEEIKKAYRKQALRFHPDKNKSAGAEDKFKEIAEAYDVLSDAKKKDIYDRYG 68

  Fly    95 VSDIN----------------------SQYFQKKHDYSEYNRFTLNQN-----DDDFG------- 125
            ...:.                      :::|..:..:..:.......|     ||.||       
Zfish    69 EDGLKGHAGSGTNGPSYTFHGDPHAMFAEFFGGRSPFDHFFASAGGPNDGMDIDDPFGAFGMGGM 133

  Fly   126 ----QRF-----------DIKQDIAFYQKLSIT-ENYF----EKMILS-----------KNAKKV 159
                :.|           :.|:|.....:|.:: |..|    :||.:|           :|..|:
Zfish   134 GGFPRSFKSRVGGPHGSREKKKDPPVVHELKVSLEEVFAGCTKKMKISRKRLNPDGCSMRNEDKI 198

  Fly   160 HVVMFYNDWCFKCTRIVDAFKKILELLQ---PIGINFATVNAVHEESVFRKCGA 210
            ..|.....| .:.|:|  .|.|..:...   |..|.|...:.:|  ||||:.|:
Zfish   199 LTVDIKRGW-KEGTKI--TFPKEGDETPTNIPADIVFVVKDKIH--SVFRRDGS 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 28/63 (44%)
DnaJ 30..91 CDD:278647 26/60 (43%)
TRX_DnaJ 134..244 CDD:239261 23/96 (24%)
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 62/249 (25%)
DnaJ 4..65 CDD:278647 26/60 (43%)
DnaJ_C 157..321 CDD:199909 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.