DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajb4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001003455.1 Gene:dnajb4 / 445061 ZFINID:ZDB-GENE-040801-192 Length:340 Species:Danio rerio


Alignment Length:431 Identity:89/431 - (20%)
Similarity:143/431 - (33%) Gaps:169/431 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.|.||||.|.|:..:|::||::.|.||||||.|.....|||.::..|||:|:|..:|.|:|:||
Zfish     4 DYYKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKKREIYDQYG 68

  Fly    95 VSDI------------NSQYFQKKHDYSEYNRF-------------TLNQNDDD---------FG 125
            ...:            |..|......::.:..|             .:|..|:|         ||
Zfish    69 EEGLKGGGGASDGPGGNFTYTFHGDPHATFATFFGGASPFEVFFGRKVNGRDEDDMEVDGNDPFG 133

  Fly   126 Q--RFDI-----------------KQDIAFYQKLSIT-ENYF----EKMILSKNAKKVHVVMFYN 166
            .  .|:|                 |||.|.:.:|.:: |..|    ::|.:|:            
Zfish   134 SFTSFNINGFPRERHVGQGGPPRRKQDPAIHHELRVSLEEVFHGSTKRMKISR------------ 186

  Fly   167 DWCFKCTRIVDAFKKILELLQPIGINFATVNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDHS 231
                             :.|.|.|....|.:.:....:  |.|.:|..::.        ..|:..
Zfish   187 -----------------KRLNPDGRTLRTEDKILTIEI--KRGWKEGTKIT--------FPREGD 224

  Fly   232 FTPQKV---VEFIRKKIPFNVFKRIEHDNFNDFLGGWSDNRARALIFEPRSLTRLRYLLTAFEFY 293
            .||..:   :.|:.|..|...|:|                                         
Zfish   225 ETPNTIPADIVFVIKDKPHGHFRR----------------------------------------- 248

  Fly   294 DRVAFGFVNTISKDSSNIITRFKVNTSL-DTLILFNEDTTTFTASVCMEEIPNHILVNM--VSTN 355
                         :.|:|:  :.|..|| .:|...:...:|.....|..:|.:.|...|  |...
Zfish   249 -------------EGSDIV--YPVRVSLRQSLCGCSVTVSTIDGKTCNMKITDVIKPGMRKVIAG 298

  Fly   356 QFLAFPRISSQ----------NIMESVCPTEWNRQRKHLCV 386
            |.|.||:...|          |..||:.....:..::||.|
Zfish   299 QGLPFPKNPEQRGDLIVEFDVNFPESLPTNAKDVLKRHLPV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 30/63 (48%)
DnaJ 30..91 CDD:278647 29/60 (48%)
TRX_DnaJ 134..244 CDD:239261 17/117 (15%)
dnajb4NP_001003455.1 DnaJ 1..334 CDD:223560 86/424 (20%)
DnaJ 4..65 CDD:278647 29/60 (48%)
DnaJ_C 163..325 CDD:199909 39/256 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.