powered by:
Protein Alignment l(3)80Fg and CG8476
DIOPT Version :9
Sequence 1: | NP_001015187.2 |
Gene: | l(3)80Fg / 3354941 |
FlyBaseID: | FBgn0287183 |
Length: | 780 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_731777.1 |
Gene: | CG8476 / 41624 |
FlyBaseID: | FBgn0038127 |
Length: | 242 |
Species: | Drosophila melanogaster |
Alignment Length: | 60 |
Identity: | 21/60 - (35%) |
Similarity: | 37/60 - (61%) |
Gaps: | 0/60 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFD 91
|.:|.:...::..||:.|:.||:||:|||.......:|.|::|..||:.|..::.|:|:|
Fly 39 YQVLNVPVGSSDREIKRAFIELSKKYHPDANSQTRDSEVFMKICEAYQTLHRVNSRQIYD 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0715 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.