DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and CG6693

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001262473.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster


Alignment Length:153 Identity:36/153 - (23%)
Similarity:66/153 - (43%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SYIHVCS---SLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA---EKFIQIKLAY 78
            |.:.:|.   ...|.|.::.:.:.|...|:::||.:|:...|||:|..:..|   |||..:...|
  Fly     2 STLELCEKYFGTRDVYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLY 66

  Fly    79 EILADLDRRRIFDRYGVSDINSQYFQKKHDYSE-----YNRFTLNQNDDDFGQRFDIKQDIAFYQ 138
            ::|.|..:|.::|..||.|.:.:...|...:.|     :...|              ::||..|:
  Fly    67 QVLTDTQKRALYDEQGVIDDDDESESKLSSWLELWSKIFKPIT--------------EEDINNYE 117

  Fly   139 KLSITENYFEKMILSKNAKKVHV 161
            |     .|.|..:...:.||.::
  Fly   118 K-----EYVESELERTDLKKAYL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 20/66 (30%)
DnaJ 30..91 CDD:278647 19/63 (30%)
TRX_DnaJ 134..244 CDD:239261 7/28 (25%)
CG6693NP_001262473.1 DnaJ 15..79 CDD:278647 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.