DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and CG11035

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster


Alignment Length:141 Identity:41/141 - (29%)
Similarity:68/141 - (48%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVK-NDYGAEKFIQIKLAYEILADLDRRRIFDRYGV 95
            |..|||.::.|..||:.||.:|:..:|||:.: ::..|:||.:|..|||||.:...||::|:..|
  Fly    29 YDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIV 93

  Fly    96 SDINSQYFQKKHDYSE------------YNRFTLNQNDDD----------------FGQRFDIKQ 132
            ....:||.|..||.:|            .:||..::..|.                :|:.||.:|
  Fly    94 HTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRRQ 158

  Fly   133 DI-AFYQKLSI 142
            .. |.|.::.:
  Fly   159 AAQAKYDRIKV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 25/62 (40%)
DnaJ 30..91 CDD:278647 24/59 (41%)
TRX_DnaJ 134..244 CDD:239261 2/10 (20%)
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/59 (41%)
DnaJ 27..89 CDD:278647 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.