DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and Csp

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	NP_001287144.1	Gene:	Csp / 40459	FlyBaseID:	FBgn0004179	Length:	249	Species:	Drosophila melanogaster

Alignment Length:	64	Identity:	29/64 - (45%)
Similarity:	43/64 - (67%)	Gaps:	1/64 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.|||:.|.||..:|::.|::||.|:|||| ..|...|:||.::..|:.||:|..:|.|:|.||
  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	27/62 (44%)
		DnaJ	30..91	CDD:278647	26/59 (44%)
		TRX_DnaJ	134..244	CDD:239261
Csp	NP_001287144.1	DnaJ	17..>86	CDD:223560	29/64 (45%)
Csp	NP_001287144.1	DnaJ	17..79	CDD:278647	26/59 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45464404
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	1.840