DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and dnajc2

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	NP_997976.1	Gene:	dnajc2 / 403080	ZFINID:	ZDB-GENE-040426-1912	Length:	618	Species:	Danio rerio

Alignment Length:	170	Identity:	48/170 - (28%)
Similarity:	61/170 - (35%)	Gaps:	70/170 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly    30 DPYAILG---INKKATTYEIREAYKELAKKWHPDKVK----------NDYGAEKFIQIKLAYEIL 81
            |.||:||   :..|||..:|:.|:|.:..|.||||.|          |||    |..|..|.|||
Zfish    85 DHYAVLGLAHVRYKATQKQIKAAHKAMVLKHHPDKRKAAGEQIVEGDNDY----FTCITKAIEIL 145

  Fly    82 ADLDRRRIFDRYGVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRFDIKQDIAFYQKLSITENY 146
            :|..:||.||..                           |..|        |.|...|....||:
Zfish   146 SDPVKRRAFDSV---------------------------DPTF--------DNAVPTKAEGKENF 175

  Fly   147 FEKM--ILSKNAK---KVH-------------VVMFYNDW 168
            ||..  :..:||:   |.|             |..||:.|
Zfish   176 FEVFAPVFERNARWSVKKHFPSLGTMESSFEDVDNFYSFW 215

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	31/76 (41%)
		DnaJ	30..91	CDD:278647	29/73 (40%)
		TRX_DnaJ	134..244	CDD:239261	14/53 (26%)
dnajc2	NP_997976.1	ZUO1	72..402	CDD:227594	48/170 (28%)
		DnaJ	85..155	CDD:278647	29/73 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	281..315
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	330..349
		RAC_head	346..416	CDD:293322
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	419..448
		SANT	450..504	CDD:197842
		SANT	450..502	CDD:238096
		SANT	552..601	CDD:197842
		SANT	552..599	CDD:238096
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170592345
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930