DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnaja3b

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_958499.1 Gene:dnaja3b / 394242 ZFINID:ZDB-GENE-040115-3 Length:474 Species:Danio rerio


Alignment Length:382 Identity:84/382 - (21%)
Similarity:136/382 - (35%) Gaps:110/382 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TTSYIHVCSSL--NDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA-EKFIQIKLAYE 79
            ::.:.|..|..  .|.|.:||:.:.|:..||::||.:||||:|||...:|..| |||.::..|||
Zfish    72 SSHFFHTSSGFRQQDFYEVLGVPRTASQKEIKKAYYQLAKKYHPDTNPDDPDAKEKFAKLAEAYE 136

  Fly    80 ILADLDRRRIFDRYGVSDINS------QYFQKKHDYSE-------YNRFTLNQNDDDFGQRFDIK 131
            .|:|..:|:.:|.||.:..::      ||::...:...       :..|...:...|....||  
Zfish   137 TLSDELKRKQYDTYGSAGPSASGTGQQQYWRGSANVDPEELFRKIFGEFAGGRGFGDINSMFD-- 199

  Fly   132 QDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDWCFKCT-RIVDAFKKILELLQPIGINFAT 195
            |...|..:||.       |..:|...| .:.:..:|.|.:|. :..:...|:.......|....:
Zfish   200 QAPEFVMELSF-------MQAAKGVNK-EITVNIDDDCPRCDGKAFEPGTKVSHCHYCNGTGMES 256

  Fly   196 VNA--VHEESVFRKCGAREVPQLVLILDNQYFLYRDHSFTPQK---------------------- 236
            :|.  ....|..|:|..|.     .|:.....:.|....|.||                      
Zfish   257 INTGPFMMRSACRRCSGRG-----FIIITPCIMCRGSGQTKQKQTVMVPVPAGIADGQTVKVPVG 316

  Fly   237 ----VVEFIRKKIPFNVFKRIEHDNFND--------FLG-------------------------- 263
                .:.|..:|.|  ||:|...|..:|        .||                          
Zfish   317 KKHMYITFRVQKSP--VFRRDGADIHSDVLISIAQAILGGTARAQGLYSTIDIAIPPGIQTDHKI 379

  Fly   264 -------------GWSDNRARALIFEPRSLT-RLRYLLTAFEFYDRVAFGFVNTISK 306
                         |:.|:.....|..|:.|| |.:.||.:|...:....|.||.::|
Zfish   380 KLEGKGIPRMNSFGYGDHYVYIKIKIPKKLTRRQKMLLLSFAEDEEDVEGTVNGVTK 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 28/64 (44%)
DnaJ 30..91 CDD:278647 27/61 (44%)
TRX_DnaJ 134..244 CDD:239261 22/138 (16%)
dnaja3bNP_958499.1 DnaJ 85..428 CDD:223560 78/359 (22%)
DnaJ 86..148 CDD:278647 27/61 (44%)
DnaJ_C 203..409 CDD:199909 35/220 (16%)
DnaJ_zf 229..289 CDD:199908 11/64 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.