DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc5aa

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001002464.1 Gene:dnajc5aa / 386768 ZFINID:ZDB-GENE-031113-20 Length:202 Species:Danio rerio


Alignment Length:64 Identity:29/64 - (45%)
Similarity:45/64 - (70%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.:||::|.||..:|:::|::||.|:|||| ..|...|:||.:|..|:.||.|..:|.|:|:||
Zfish    18 YHVLGVDKVATVDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILNDPTKRNIYDKYG 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 27/62 (44%)
DnaJ 30..91 CDD:278647 26/59 (44%)
TRX_DnaJ 134..244 CDD:239261
dnajc5aaNP_001002464.1 DnaJ 16..>85 CDD:223560 29/64 (45%)
DnaJ 16..78 CDD:278647 26/59 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.