DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and CG2790

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster


Alignment Length:237 Identity:56/237 - (23%)
Similarity:100/237 - (42%) Gaps:48/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDY--GAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |..|.:.:.|...:|:.||:::|.:|||||..:..  ..|:|..|:.|||:|:|...|..:|.:.
  Fly     5 YEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYDNHR 69

  Fly    95 VSDINSQYFQKKHDYSE-----YNRFT------LNQNDDDFGQRF-DI-----KQDIAFYQK--- 139
            ...:..    |..||:|     :..||      ...|:..|.:.: |:     .:|:.|..|   
  Fly    70 EQILRG----KNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDR 130

  Fly   140 LSITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVDAFKKILELLQPIGINFATVNAVHEESV 204
            |.:..::..    |.::.:..|..||..|....||      |..:.|.|.     .|..:.|..:
  Fly   131 LGMAPDFGH----SNSSYEDVVGPFYAFWQAYSTR------KTYDWLCPY-----DVREIKERFI 180

  Fly   205 FRKCGAREVPQLVLILDNQYFLYRDHSFTPQKVVEFIRKKIP 246
            .||. .:|:.::|      ....::.:...:.:|.|:||:.|
  Fly   181 LRKV-EKEMKKIV------QAARKERNEEVRNLVNFVRKRDP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 22/63 (35%)
DnaJ 30..91 CDD:278647 21/60 (35%)
TRX_DnaJ 134..244 CDD:239261 22/112 (20%)
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 21/60 (35%)
ZUO1 19..>252 CDD:227594 53/223 (24%)
zf-C2H2_jaz 313..337 CDD:288983
C2H2 Zn finger 315..337 CDD:275371
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.