DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and CG8531

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:535 Identity:105/535 - (19%)
Similarity:186/535 - (34%) Gaps:173/535 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQI-----KLAYEILADLDRRRIFD 91
            |..|.:.:.||..:|..||::.::.:|||| ..|..::|..:|     |.|||:|:|..:|.|:|
  Fly    17 YTFLNLPRDATAEQINTAYRKQSRMFHPDK-HLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIYD 80

  Fly    92 RYGVSDINSQYFQKKHD-------YSEYNR-------------------FTLNQNDDDFGQRFDI 130
            ..|...:.::.::..|.       ..||.|                   .|:|.|..:....:|.
  Fly    81 SVGEKGLRTEGWEILHRTKTPDEIREEYERLAQAAAERRLQQRTNPRGNITINVNATEIFAPYDD 145

  Fly   131 KQ-------DIAFYQKLSITENYFEKMILSKNAKKVH-------VV----MFYNDWCFKCTRIVD 177
            .:       .::..|.:.......:.:|:|.|....:       |:    :....|...|....:
  Fly   146 SEMPHVEIGSMSIAQSIEAPITRKDMIIMSGNLYSSNGNGSGGFVIAGRRLLNKGWIELCAGAGN 210

  Fly   178 AFKKILE----LLQPIGINFAT-VNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDHSFTPQKV 237
            .|...|:    |.|.:.:|..| :|       ||..|.  :|.|...|..|...:...|.|    
  Fly   211 GFLLGLKGGRTLSQKLTLNGGTNLN-------FRDQGV--IPALFSTLAVQLDKHTMGSLT---- 262

  Fly   238 VEFIRKKIPFNVFKRIEHDNFNDFLGGWSDNRARALIFEPR-----SLTR------LRYLLTA-- 289
               :......::..:|:|......|.      :..:|..|.     |.||      |:..|.|  
  Fly   263 ---LNAGSQSSMSTQIDHSKETYSLS------SSLVIGTPHVYFGLSYTRKMMENELKLKLAAKV 318

  Fly   290 --FEFYDRVAFGFVNTISKDSSNIITRFKVNTSLDTLILFNEDTTTFTASVCMEEIPNHILV--N 350
              |.|...  :|....:||.||                      .|.|.|:   .:|:.:::  .
  Fly   319 GTFGFMGE--YGVEKKVSKYSS----------------------VTATVSI---GVPSGVILKFK 356

  Fly   351 MVSTNQFLAFPRISSQNIMESVCPTEWNRQRKHLCVILITENNRKKDFERVALRNIALSVGYNSE 415
            ::.:||...||...|..|                                     :..:|.|.|.
  Fly   357 ILRSNQSYVFPIHLSDEI-------------------------------------VPAAVFYASV 384

  Fly   416 KVRFAYIF-KESQPDFIKSISKGSFKDSLIEIVIIWRRDKKRIKYNWVYVAKQNGNSSPEHLMNS 479
            ....|:.| |.:..|.:::..|.      ||:....|::::|:.      ||::..|:..|||.:
  Fly   385 TPVIAWFFIKRTVMDPMEAERKN------IEVERTKRQNEQRLS------AKRHEASAAVHLMQA 437

  Fly   480 TKDQISNAVKKLLKN 494
            |.::|  ..::|.:|
  Fly   438 TYNRI--MTEELARN 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 23/66 (35%)
DnaJ 30..91 CDD:278647 22/63 (35%)
TRX_DnaJ 134..244 CDD:239261 23/125 (18%)
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 24/74 (32%)
DnaJ 15..80 CDD:278647 22/63 (35%)
DUF3395 409..538 CDD:288708 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.