DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc24

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:126 Identity:30/126 - (23%)
Similarity:63/126 - (50%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA-------EKFIQIKLAYEILADLDRR 87
            |.|:|||.:..|...::::.|::|...:||||...|..|       :|||:|..|::||.:.:.:
  Rat    10 DWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEETK 74

  Fly    88 RIFD--RY-----GVSDINSQYFQKKHDYSEYNRFTLNQNDDDF------GQRFDIKQDIA 135
            :.:|  |:     .|..:::|...::..:        |::::.|      |.::.:.:|.|
  Rat    75 KKYDLQRHEDELRNVGPVDAQVHLEEMSW--------NKDEESFSLSCRCGGKYTVYKDEA 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 23/77 (30%)
DnaJ 30..91 CDD:278647 21/67 (31%)
TRX_DnaJ 134..244 CDD:239261 1/2 (50%)
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 21/67 (31%)
zf-CSL 94..147 CDD:398744 6/42 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.