DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_008758381.1 Gene:Dnajc4 / 361717 RGDID:1308693 Length:260 Species:Rattus norvegicus


Alignment Length:168 Identity:35/168 - (20%)
Similarity:65/168 - (38%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYG----AEKFIQIKLAYEILADLDRRRIFD- 91
            |.:||::..|:..||:.|:...:|:.|||:   |.|    ..:|:::..||.:|:..:.||.:| 
  Rat    55 YELLGVHPGASAEEIKRAFFTKSKELHPDR---DPGNPALHSRFVELSEAYRVLSREESRRNYDH 116

  Fly    92 --------RYGVSDINSQYFQKKH---------DYSEYNRFTLNQNDDDFGQRFDIKQDIAFYQK 139
                    :...|....:|.|:.|         :|.........|..:...|:....|.:..|..
  Rat   117 QLHSASPSKSSGSTAEPKYKQQTHSSPWETPNAEYWAQFHSVRPQEPESRKQQHKHNQRVLGYCL 181

  Fly   140 LSITENYFEKMILSKNAKKVH----------VVMFYND 167
            |.:........:..:..::||          :...|||
  Rat   182 LLMVAGMGLHYVAFRKLEQVHRSFMDEKDRIITAIYND 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 20/74 (27%)
DnaJ 30..91 CDD:278647 19/62 (31%)
TRX_DnaJ 134..244 CDD:239261 7/44 (16%)
Dnajc4XP_008758381.1 DnaJ 53..115 CDD:395170 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.